PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID SapurV1A.0235s0230.2.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Salix
Family GRF
Protein Properties Length: 599aa    MW: 65431.5 Da    PI: 8.1701
Description GRF family protein
Gene Model
Gene Model ID Type Source Coding Sequence
SapurV1A.0235s0230.2.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRC76.52.7e-24224268145
                     WRC   1 daepgrCrRtDGKkWRCsrrvlegkklCErHlhrgrsrsrkskee 45 
                             d+epgrCrRtDGKkWRCsr++++++k+CErH++rgr+rsrk++e+
  SapurV1A.0235s0230.2.p 224 DPEPGRCRRTDGKKWRCSRDAVADQKYCERHINRGRHRSRKPVES 268
                             79****************************************986 PP

2QLQ56.86.6e-20154189237
                     QLQ   2 aFTaaQlqlLksQilAyKyLaanqPvPpeLlqaiqk 37 
                             +FT++Q+++L++Q+l+yKy+ a++PvP++L+ +++k
  SapurV1A.0235s0230.2.p 154 SFTPSQWMELEHQALIYKYITARVPVPSNLIIPLKK 189
                             8******************************99975 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM009511.2E-11153189IPR014978Glutamine-Leucine-Glutamine, QLQ
PROSITE profilePS5166622.187154189IPR014978Glutamine-Leucine-Glutamine, QLQ
PfamPF088805.1E-14154187IPR014978Glutamine-Leucine-Glutamine, QLQ
PROSITE profilePS5166725.54224268IPR014977WRC domain
PfamPF088797.7E-21225267IPR014977WRC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009624Biological Processresponse to nematode
GO:0048364Biological Processroot development
GO:0048366Biological Processleaf development
GO:0061062Biological Processregulation of nematode larval development
GO:0005634Cellular Componentnucleus
GO:0005524Molecular FunctionATP binding
Sequence ? help Back to Top
Protein Sequence    Length: 599 aa     Download sequence    Send to blast
MDFGVLGLEG LVGPKTSSEA PSHVSPPETK QKILGSVSSK QERSASSAQD DYWRTSKMPK  60
NNDFSVTKTM SLHQPASLLR SNYMFSDDSL QQEHMMSFSS PRPETTPFLR RDGGFVERST  120
QNHTASSLPY YQNTASSYIR SAGMHGTFTG VRGSFTPSQW MELEHQALIY KYITARVPVP  180
SNLIIPLKKS IYPYGLPGSS TGSFPHNSLG WSAFHLVYPG NNTDPEPGRC RRTDGKKWRC  240
SRDAVADQKY CERHINRGRH RSRKPVESQT GHAATGTASS NVLPMSNSTS KLVISSGGAS  300
NGIAMTMQQQ FKILQPAAAN SSADADVNRA QDARNISMMS STINQKSDES SFSVPKQDFS  360
MEQCSQTEFG FVSSDSLLNP SQKSSYNNSK PNESFLNFND KESQDQHAPR HFINDWPKDQ  420
SNRSVICWPE ELKSDWTQLS MSIPMASSDF SSSSSSPTHE KLALSPMRLS CEFDHVQMGL  480
RVSIDHNESS QKQTNWIPIS WGTSIGGPLG EVLTTNTSHA DSCKSSSALS LLREGCDGSP  540
QLRSSPTGVL QKSAFCSLSN SSSGSSPRAE SKKNNDTASL YEDVLGSIIA SSSPIPSL*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankLN6818753e-44LN681875.1 Cucumis melo genomic scaffold, anchoredscaffold00007.
GenBankLN7132623e-44LN713262.1 Cucumis melo genomic chromosome, chr_8.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002320668.10.0hypothetical protein POPTR_0014s00780g
TrEMBLB9IBM40.0B9IBM4_POPTR; Uncharacterized protein
STRINGPOPTR_0014s00780.10.0(Populus trichocarpa)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G22840.11e-106growth-regulating factor 1